LL-37 is a 37-residue cationic, amphipathic peptide that makes up the C-terminal domain of the human cathelicidin protein hCAP18. In solution it can adopt an α-helical structure. This drives its interaction with negatively charged lipid membranes, the property most in vitro work is built around.
In published laboratory studies, LL-37 is used in:
- Minimum inhibitory concentration and membrane-permeabilization assays in bacterial model systems
- Biofilm formation and disruption assays
- Receptor-mediated signaling and cytokine expression profiling in cultured cell lines
- Cell migration and extracellular-matrix interaction models
Published work also records its limits in vitro. Activity drops in the presence of serum, it is degraded by proteases, and it becomes cytotoxic and hemolytic at higher concentrations.
Specifications
- Sequence: [LL-37, 37 aa]
- Molecular class: cathelicidin-derived peptide
- Quantity: 5mg per vial (measured content 5.03 mg)
- Appearance: white crystals
- Purity: 99.73% (liquid chromatography); identity by mass spectrometry
- Endotoxin: ≤0.05 EU/mL, pass
- Lot: LL375-BL-7813 · COA 261108, MDx BioAnalytical, reported 18 Mar 2026 (see COAs tab)
Storage: Store lyophilized material at −20 °C, protected from light and moisture.
For in vitro laboratory research use only. Not for human or veterinary use. Not a drug, food, cosmetic, or dietary supplement. Not for diagnostic or therapeutic use.
For in vitro laboratory research use only. Not for human or veterinary use. Not a drug, food, cosmetic, or dietary supplement. Not for diagnostic or therapeutic use.
COAs:
LL-37 5mg – COA261108 QC260991
Each batch of LL-37 is supported by third-party analytical verification to ensure identity, purity, and consistency. Documentation is provided for transparency and to support reproducibility across research applications.
